123780-BIOTIN

B3GNT6 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, I-beta-1,3-N-acetylglucosaminyltransferase, iGnT, Poly-N-acetyllactosamine Extension Enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1, B3GNT1, MGC119334, MGC119336, MGC119337) (Biotin)

Größe

£927.00

SKU:: 123780-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa316-416 from human B3GNT6 (NP_006867) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.