AZIN1 (Antizyme Inhibitor 1, AZI, Ornithine Decarboxylase Antizyme Inhibitor, OAZI, OAZIN, MGC3832, MGC691)

Größe

£685.00

SKU:: 123769
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa339-448 from human AZIN1 (NP_056962) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Regulates cellular polyamine homeostasis. Inhibits antizyme-dependent ornithine decarboxylase degradation by binding to antizyme. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDSFSAE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.