Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK2, STK12)

Größe

£685.00

SKU:: 123760
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-90 from AURKB (AAH09751) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6G8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases associate with microtubules during chromosome movement and segregation. STK12 (Aurora kinase B) localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers, and Aurora kinase A localizes to centrosomes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.