ATP7B (Copper-transporting ATPase 2, Copper Pump 2, Wilson Disease-associated Protein, WND/140kD, WND, WC1, PWD)

Größe

£685.00

SKU:: 123742
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1372-1465 from human ATP7B (NP_000044) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ATP7B is a member of the P-type cation transport ATPase family and a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.