ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2)

Größe

£685.00

SKU:: 123721
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa508-617 from human ATP6V1A (NP_001681) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Applications: Suitable for use in ELISA, Western Blot, Immunofluorescence and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.