123699-PE

ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1) (PE)

Größe

£914.00

SKU:: 123699-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-97 from human ATP2B1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E2
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.