123699-FITC
ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1) (FITC)
Größe
£914.00
- SKU:
- 123699-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-97 from human ATP2B1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E2
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice