123690
ATOH7 (Protein Atonal Homolog 7, Class A Basic Helix-loop-helix Protein 13, bHLHa13, Helix-loop-helix Protein hATH-5, hATH5, ATH5, BHLHA13)
Größe
£685.00
- SKU:
- 123690
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa53-99 from human ATOH7 (NP_660161) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Transcription factor involved in the differentiation of retinal ganglion cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice