123689
ATOH7 (Protein Atonal Homolog 7, Class A Basic Helix-loop-helix Protein 13, bHLHa13, Helix-loop-helix Protein hATH-5, hATH5, ATH5, BHLHA13)
Größe
£760.00
- SKU:
- 123689
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human ATOH7, aa1-152 (NP_660161.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Transcription factor involved in the differentiation of retinal ganglion cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice