ATOH1 (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1)

Größe

£685.00

SKU:: 123688
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa266-354 from human ATOH1 (NP_005163.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Math1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. It is neural-specific and is switched on during differentiation into neuroectoderm. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.