123594-HRP

ASAP1 (Arf-GAP with SH3 Domain, ANK Repeat and PH Domain-containing Protein 1, 130kD Phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating Protein, ADP-ribosylation Factor-directed GTPase-activating Protein 1, ARF GTPase-activating Protein 1, Development and Differentiation-enhancing Factor 1, DEF-1, Differentiation-enhancing Factor 1, DDEF1, KIAA1249, PIP2-dependent ARF1 GAP) (HRP)

Größe

£914.00

SKU:: 123594-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1030-1130 from human DDEF1 (NP_060952) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: Possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice