ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT)

Größe

£685.00

SKU:: 123593
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa36-104 from human ASAHL with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5E3
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications have not been tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.