123581-ML550
ART3 (Ecto-ADP-ribosyltransferase 3, NAD(P)(+)-arginine ADP-ribosyltransferase 3, Mono(ADP-ribosyl) Transferase 3, TMART) (MaxLight 550)
Größe
£914.00
- SKU:
- 123581-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa29-138 from human ART3 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A2
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Mono-ADP-ribosylation involves the transfer of the ADP-ribose moiety from NAD+ to a specific amino acid in the target protein. The rodent mono-ADP-ribosyltransferase RT6 is a glycosylphosphatidylinositol (GPI)-anchored membrane protein specifically expressed at the cell surface of rat and mouse T lymphocytes. The predicted 367aa human ART3 protein has an estimated molecular mass of 41.5kD and contains a hydrophobic peptide signal at its N terminus, 3 consensus motifs specific to enzymes catalyzing ADP-ribose transfer, a hydrophobic C-terminal sequence characteristic of a GPI-anchored protein, a novel motif repeated 3 times at its C terminus, and 1 potential glycosylation site.1 The ART3 and rodent RT6 proteins share 35% amino acid identity. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice