123581-HRP
ART3 (Ecto-ADP-ribosyltransferase 3, NAD(P)(+)-arginine ADP-ribosyltransferase 3, Mono(ADP-ribosyl) Transferase 3, TMART) (HRP)
Größe
£914.00
- SKU:
- 123581-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa29-138 from human ART3 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A2
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Horseradish peroxidase (HRP).
- Weitere Details:
- Mono-ADP-ribosylation involves the transfer of the ADP-ribose moiety from NAD+ to a specific amino acid in the target protein. The rodent mono-ADP-ribosyltransferase RT6 is a glycosylphosphatidylinositol (GPI)-anchored membrane protein specifically expressed at the cell surface of rat and mouse T lymphocytes. The predicted 367aa human ART3 protein has an estimated molecular mass of 41.5kD and contains a hydrophobic peptide signal at its N terminus, 3 consensus motifs specific to enzymes catalyzing ADP-ribose transfer, a hydrophobic C-terminal sequence characteristic of a GPI-anchored protein, a novel motif repeated 3 times at its C terminus, and 1 potential glycosylation site.1 The ART3 and rodent RT6 proteins share 35% amino acid identity. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice