ARL8B (ADP-ribosylation Factor-like Protein 8B, ADP-ribosylation Factor-like Protein 10C, Novel Small G-Protein Indispensable for Equal Chromosome Segregation 1, ARL10C, GIE1, FLJ10702)

Größe

£685.00

SKU:: 123540
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-187 from human ARL8B (AAH13131) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May play a role in lysosome motility. May play a role in chromosome segregation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.