ARL6IP4 (ADP-ribosylation Factor-like Protein 6-interacting Protein 4, ARL-6-interacting Protein 4, Aip-4, HSP-975, HSVI-binding Protein, SR-15, SRp25, SR-25, MGC814)

Größe

£685.00

SKU:: 123537
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa261-361 from human ARL6IP4 (NP_061164) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: In case of infection by Herpes simplex virus (HSVI), may act as a splicing inhibitor of HSVI pre-mRNA. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.