ARIH2 (E3 Ubiquitin-protein Ligase ARIH2, ARI-2, Protein Ariadne-2 Homolog, Triad1 Protein, ARI2, TRIAD1, HT005)

Größe

£698.00

SKU:: 123522
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa331-420 from ARIH2 (NP_006312) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C3
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. May play a role in myelopoiesis. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.