123469
ARFIP2 (ADP Ribosylation Factor Interacting Protein 2, Arfaptin 2, Partner of RAC1, POR1)
Größe
£685.00
- SKU:
- 123469
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from ARFIP2 (AAH00392) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Arfaptin 2, or ADP-ribosylation factor interacting protein 2, is a Rac1 binding protein necessary for Rac-mediated actin polymerization and the subsequent formation of membrane ruffles and lamellipodia.1 Arfaptin-2 has been shown to be involved in interactions between the Rac and ARF signaling pathways.2 Arfaptin 2 also regulates the aggregation of mutant Huntingtin protein by possibly impairing proteasome function. Expression of Arfaptin 2 was shown to be increased at sites of neurodegeneration. Mutant Huntingtin protein is characteristic of Huntington's disease, an inherited neurodegenerative disorder. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: :MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice