123469-BIOTIN
ARFIP2 (ADP Ribosylation Factor Interacting Protein 2, Arfaptin 2, Partner of RAC1, POR1) (Biotin)
Größe
£927.00
- SKU:
- 123469-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from ARFIP2 (AAH00392) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Arfaptin 2, or ADP-ribosylation factor interacting protein 2, is a Rac1 binding protein necessary for Rac-mediated actin polymerization and the subsequent formation of membrane ruffles and lamellipodia.1 Arfaptin-2 has been shown to be involved in interactions between the Rac and ARF signaling pathways.2 Arfaptin 2 also regulates the aggregation of mutant Huntingtin protein by possibly impairing proteasome function. Expression of Arfaptin 2 was shown to be increased at sites of neurodegeneration. Mutant Huntingtin protein is characteristic of Huntington's disease, an inherited neurodegenerative disorder. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: :MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice