APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4)

Größe

£685.00

SKU:: 123425
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa27-127 from human APOC4 (BC020723, AAH20723) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Apolipoprotein C4 is a member of the apolipoprotein family. The gene encoding APOC4 is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.