123423-APC
APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3) (APC)
Größe
£927.00
- SKU:
- 123423-APC
- Reinheit:
- Purified by Protein A affinity chromatography
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa21-99 from human APOC3 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 8H7
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Apolipoprotein C-III (Apo CIII) is one of 9 known polymorphic forms of apolipoproteins. The apolipoproteins functions as stabilizer of the intact lipoprotein particles. Specifically, Apo CIII is a very low density lipoprotein (VLDL) protein. Apo CIII is involved inhibition of lipoprotein lipase and hepatic lipase. It is thought to delay catabolism of triglyceride-rich particles. A defect in Apo CIII has been linked to cause of hyperalphalipoproteinemia (HLAP), which causes increase levels of high density lipoprotein (HDL). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice