123394
APEG1 (Striated Muscle Preferentially Expressed Protein Kinase, Aortic Preferentially Expressed Protein 1, APEG-1, SPEG, KIAA1297)
Größe
£685.00
- SKU:
- 123394
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa1-113 from human APEG1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C2-2C7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice