AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 Adaptin sigma-1A Subunit, HA1 19kD Subunit, Sigma 1a Subunit of AP-1 Clathrin, Sigma-adaptin 1A, Sigma1A-adaptin, AP19, CLAPS1)

Größe

£685.00

SKU:: 123377
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human AP1S1, aa1-158 (NP_001274.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.