123340
ANKRD37 (LPR2BP, Ankyrin Repeat Domain-containing Protein 37, Low-density Lipoprotein Receptor-related Protein 2-binding Protein, MGC111507)
Größe
£685.00
- SKU:
- 123340
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa1-158 from human ANKRD37 (NP_859077) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6E8
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The function of this protein is unknown. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice