123340-FITC

ANKRD37 (LPR2BP, Ankyrin Repeat Domain-containing Protein 37, Low-density Lipoprotein Receptor-related Protein 2-binding Protein, MGC111507) (FITC)

Größe

£914.00

SKU:: 123340-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-158 from human ANKRD37 (NP_859077) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6E8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: The function of this protein is unknown. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.