123339-ML650
ANKRD17 (Ankyrin Repeat Domain-containing Protein 17, Gene Trap Ankyrin Repeat Protein, Serologically Defined Breast Cancer Antigen NY-BR-16, GTAR, KIAA0697) (MaxLight 650)
Größe
£914.00
- SKU:
- 123339-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2501-2604 from human ANKRD17 (NP_115593) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Earliest specific in situ marker of hepatic differentiation during embryogenesis, useful for characterization of inductive events involved in hepatic specification. Target of enterovirus 71 which is the major etiological agent of HFMD (hand, foot and mouth disease). Applications: Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice