123325-FITC
ANGPTL6 (Angiopoietin-related Protein 6, Angiopoietin-like Protein 6, Angiopoietin-related Growth Factor, Angiopoietin-related Protein 5, UNQ152/PRO178, AGF, ARP5) (FITC)
Größe
£914.00
- SKU:
- 123325-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa211-300 from human ANGPTL6 (NP_114123) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3H8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Angiopoietin-like 6 (ANGPTL6), also known as angiopoietin related growth factor (AGF), is a secreted 50kD protein that contains a coiled coil domain aa51-77, 126-164 and a fibrinogen-like domain aa238-456. A conserved Integrin binding RGD motif is located within the fibrinogen-like domain. This enables ANGPTL6 to promote skin wound healing by mediating the adhesion and migration of keratinocytes, fibroblasts, and endothelial cells. ANGPTL6 also promotes the chemotaxis of vascular endothelial cells resulting in increased vascular permeability and angiogenesis. ANGPTL6 is also secreted by hepatocytes. It inhibits gluconeogenesis in these cells and promotes insulin sensitivity and energy expenditure in mice fed high fat diets. Serum levels of ANGPTL6 are elevated in metabolic syndrome, diabetes, and preeclampsia but are decreased in chronic renal failure. ANGPTL6 is additionally produced by several hematopoietic cell types including megakaryocytes, platelets, mast cells, and uterine NK cells. Mature mouse ANGPTL6 shares 75% and 95% sequence identity with human and rat ANGPTL6. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice