123323-ML490
ANGPTL5 (Angiopoietin-related Protein 5, Angiopoietin-like Protein 5, UNQ5795/PRO19600) (MaxLight 490)
Größe
£934.00
- SKU:
- 123323-ML490
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human ANGPTL5, aa1-388 (NP_835228.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Angiopoietin-like 5 (ANGPTL5) is a secreted glycoprotein that is structurally related to the angiopoietins which contain an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain. It shares 88% and 93% aa sequence identity with bovine and porcine ANGPTL5, and greater than 98% identity with chimpanzee, orangutan, and rhesus ANGPTL5. ANGPTL5 is expressed in adipose, bronchial, epididymal, and heart tissue. Rare polymorphisms and loss of function mutations in human ANGPTL5 are associated with low circulating triglyceride levels and alterations in body mass index. ANGPTL5, when used in combination with other growth factors such as SCF, Thrombopoietin, IGF-II, FGF acidic, Flt-3 Ligand, and IGFBP-2, enhances the expansion and engraftment of human and mouse hematopoietic stem cells. The coiled-coil domain of ANGPTL proteins is critical for this effect. However, the molecular mechanism of ANGPTL proteins in stem cell activity remains unclear. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGWTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice