123321-PE
ANGPTL4 (Angiopoietin-related Protein 4, Angiopoietin-like Protein 4, Hepatic Fibrinogen/Angiopoietin-related Protein, HFARP, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197) (PE)
Größe
£934.00
- SKU:
- 123321-PE
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human ANGPTL4, aa1-406 (NP_647475.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Angiopoietin-like protein 4 (ANGPTL4), also known as PPAR angiopoietinrelated protein, fasting-induced adipose factor, or hepatic fibrinogen /angiopoietin-related protein (HFARP), is a secreted adipokine predominantly expressed in adipose tissue and liver. The experimental results show that ANGPTL4 is a blood-borne hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. Serum levels of ANGPTL4 were decreased in patients with type 2 diabetes. In animal experiments, ANGPTL4 treatments might reduce hyperglycemia, and improve glucose tolerance by decreasing hepatic glucose production and enhancing insulin-mediated inhibition of gluconeogenesis. However, the molecular mechanisms underlying its metabolic actions remain elusive. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice