ANAPC2 (Anaphase-promoting Complex Subunit 2, Cyclosome Subunit 2, APC2, KIAA1406, RP11-350O14.5)

Größe

£685.00

SKU:: 123312
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa716-823 from human ANAPC2 (NP_037498) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8G2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: APC2 (molecular weight 92kD) is a cullin-related subunit of the anaphase-promoting complex (APC), or cyclosome. APC2 specifically interacts with APC11, another APC subunit. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.