123312-APC

ANAPC2 (Anaphase-promoting Complex Subunit 2, Cyclosome Subunit 2, (APC)2, KIAA1406, RP11-350O14.5) (APC)

Größe

£927.00

SKU:: 123312-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa716-823 from human ANAPC2 (NP_037498) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8G2
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: APC2 (molecular weight 92kD) is a cullin-related subunit of the anaphase-promoting complex (APC), or cyclosome. APC2 specifically interacts with APC11, another APC subunit. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.