123310-ML490
ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (MaxLight 490)
Größe
£914.00
- SKU:
- 123310-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-55 from human ANAPC11 (AAH00607) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B4-1A4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Anaphase-promoting complex (APC) is homologous to the two highly conserved RING finger proteins ROC1 and ROC2. APC11 specifically interacts with APC2, a cullin-related APC subunit. ROC1 and APC11 immunocomplexes can catalyze isopeptide ligations to form polyubiquitin chains in an E1-and E2-dependent manner. Combinations of ROC/APC11 and cullin proteins potentially constitute a wide variety of ubiquitin ligases. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice