AMY1A (Alpha-amylase 1, 1,4-alpha-D-glucan Glucanohydrolase 1, Salivary alpha-amylase, AMY1, AMY1B, AMY1C)

Größe

£685.00

SKU:: 123303
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa172-245 of human AMY1A with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D4
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: Salivary Amylase is a digestive enzyme secreted by salivary glands, it consists of a single polypeptide chain with a molecular weight of 56kD (family B) or 62kD (family A), the difference in molecular weight being due to the presence or absence of a carbohydrate moiety. The total serum concentration of amylase is about 120g/L of which about 50% is salivary amylase. Although salivary amylase and pancreatic amylase share 95% aa sequence homology, they differ in molecular size, isoelectricpoint and antigenic properties. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.