123303-ML650
AMY1A (Alpha-amylase 1, 1,4-alpha-D-glucan Glucanohydrolase 1, Salivary alpha-amylase, AMY1, AMY1B, AMY1C) (MaxLight 650)
Größe
£914.00
- SKU:
- 123303-ML650
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa172-245 of human AMY1A with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Salivary Amylase is a digestive enzyme secreted by salivary glands, it consists of a single polypeptide chain with a molecular weight of 56kD (family B) or 62kD (family A), the difference in molecular weight being due to the presence or absence of a carbohydrate moiety. The total serum concentration of amylase is about 120g/L of which about 50% is salivary amylase. Although salivary amylase and pancreatic amylase share 95% aa sequence homology, they differ in molecular size, isoelectricpoint and antigenic properties. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice