AMBP (a1-Microglobulin, Alpha-1-Microglobulin, A1M, Alpha-1-Microglobulin/bikunin Precursor, AMBP Protein, Alpha-1 Microglycoprotein, EDC1, Growth Inhibiting Protein 19, HCP, HI30, ITI, ITIL, IATIL, ITILC, Protein HC, UTI)

Größe

£685.00

SKU:: 123277
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa19-352 from human AMBP (AAH41593) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Alpha1-Microglobulin is strongly associated with a yellow-brown chromophore of unknown structure and about half the plasma alpha1-Microglobulin is convalently linked to monomeric IgA. The plasma concentration range is 20-100mg/L. The function is not known. It has been implicated in immunoregulation and through its translation as a diprotein with bikunin it is associated with proteolysis inhibition. Elevated levels are associated with renal disorders and abnormalities of the renal tubules, elevated plasma IgA. Sub-normal levels are associated with HIV-infection, some liver dysfunctions and decreased plasma IgA. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice