123277-APC
AMBP (a1-Microglobulin, Alpha-1-Microglobulin, A1M, Alpha-1-Microglobulin/bikunin Precursor, AMBP Protein, Alpha-1 Microglycoprotein, EDC1, Growth Inhibiting Protein 19, HCP, HI30, ITI, ITIL, IATIL, ITILC, Protein HC, UTI) (APC)
Größe
£927.00
- SKU:
- 123277-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa19-352 from human AMBP (BC041593, AAH41593) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F1
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Alpha1-Microglobulin is strongly associated with a yellow-brown chromophore of unknown structure and about half the plasma alpha1-Microglobulin is convalently linked to monomeric IgA. The plasma concentration range is 20-100mg/L. The function is not known. It has been implicated in immunoregulation and through its translation as a diprotein with bikunin it is associated with proteolysis inhibition. Elevated levels are associated with renal disorders and abnormalities of the renal tubules, elevated plasma IgA. Sub-normal levels are associated with HIV-infection, some liver dysfunctions and decreased plasma IgA. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice