ALPPL2 (Alkaline Phosphatase, Placental-like, ALP-1, Alkaline Phosphatase Nagao Isozyme, Germ Cell Alkaline Phosphatase, GCAP, Placental Alkaline Phosphatase-like, PLAP-like, ALPPL)

Größe

£685.00

SKU:: 123265
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa365-454 from human ALPPL2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Trace amounts in the testis and thymus, and in elevated amounts in germ cell tumors. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.