123265-HRP
ALPPL2 (Alkaline Phosphatase, Placental-like, ALP-1, Alkaline Phosphatase Nagao Isozyme, Germ Cell Alkaline Phosphatase, GCAP, Placental Alkaline Phosphatase-like, PLAP-like, ALPPL) (HRP)
Größe
£914.00
- SKU:
- 123265-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa365-454 from human ALPPL2 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B3
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Horseradish peroxidase (HRP).
- Weitere Details:
- Trace amounts in the testis and thymus, and in elevated amounts in germ cell tumors. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. Aminno Acid Sequence: SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice