ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II)

Größe

£685.00

SKU:: 123248
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa181-280 from human ALOX15B (AAH35217) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while linoleic acid is less well metabolized. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.