ALG8 (Probable Dolichyl Pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase, Asparagine-linked Glycosylation Protein 8 Homolog, Dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl Glucosyltransferase, MGC2840)

Größe

£685.00

SKU:: 123236
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa260-335 from human ALG8 (NP_076984) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.