ALDH9A1 (R-aminobutyraldehyde Dehydrogenase, Gamma-aminobutyraldehyde Dehydrogenase, Aldehyde Dehydrogenase E3 Isozyme, Aldehyde Dehydrogenase Family 9 Member A1, 4-trimethylaminobutyraldehyde Dehydrogenase, TMABADH, ALDH4, ALDH7, ALDH9)

Größe

£685.00

SKU:: 123219
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa173-270 from human ALDH9A1 (NP_000687) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ALDH9A1 belongs to the aldehyde dehydrogenase family of proteins. The protein has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54kD subunits. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.