123219-BIOTIN
ALDH9A1 (R-aminobutyraldehyde Dehydrogenase, Gamma-aminobutyraldehyde Dehydrogenase, Aldehyde Dehydrogenase E3 Isozyme, Aldehyde Dehydrogenase Family 9 Member A1, 4-trimethylaminobutyraldehyde Dehydrogenase, TMABADH, ALDH4, ALDH7, ALDH9) (Biotin)
Größe
£927.00
- SKU:
- 123219-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa173-270 from human ALDH9A1 (NP_000687) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- ALDH9A1 belongs to the aldehyde dehydrogenase family of proteins. The protein has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54kD subunits. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice