ALAS2 (5-aminolevulinate Synthase, Erythroid-specific, Mitochondrial, ALAS-E, 5-aminolevulinic acid Synthase 2, Delta-ALA Synthase 2, Delta-aminolevulinate Synthase 2, ALASE, ASB)

Größe

£685.00

SKU:: 123187
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-100 from human ALAS2, with GST tag. MW of the GST tag alone is 26kD. Species sequence homology: rat
Klon:: 6C1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. It catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.