123162-FITC
AKR1C2 (Aldo-keto Reductase Family 1 Member C2, 3-alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-binding Protein, DD/BABP, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, Type III 3-alpha-hydroxysteroid Dehydrogenase, DDH2) (FITC)
Größe
£914.00
- SKU:
- 123162-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa224-323 from human AKR1C2 (AAH63574) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- AKR1C2 is a member of the aldo-oxo reductase (AKR) superfamily. It catalyzes the NADP-linked oxidation of trans-dihydrodiols of aromatic hydrocarbons to corresponding catechols. AKR1C2 works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. It catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). AKR1C2 has a high bile-binding ability. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice