AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3)

Größe

£685.00

SKU:: 123149
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa111-210 from human C11orf17 (NP_065693) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: C11orf17 is a nuclear protein and known to bind to the amino terminus (residues 1-39) of the C subunit of PKA. It is a binding partner of NF-kappaB p65 subunit, and enhances NF-kappaB-mediated gene expression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.