123149-BIOTIN

AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3) (Biotin)

Größe

£927.00

SKU:: 123149-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa111-211 from human C11orf17 (NP_065693) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: C11orf17 is a nuclear protein and known to bind to the amino terminus (residues 1-39) of the C subunit of PKA. It is a binding partner of NF-kappaB p65 subunit, and enhances NF-kappaB-mediated gene expression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.