AKAP5 (AKAP79, A-kinase Anchor Protein 5, AKAP-5, A-kinase Anchor Protein 79kD, AKAP 79, H21, cAMP-dependent Protein Kinase Regulatory Subunit II High Affinity-binding Protein)

Größe

£685.00

SKU:: 123137
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa334-427 from AKAP5 (NP_004848) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.