123135-BIOTIN
AKAP13 (A-kinase Anchor Protein 13, AKAP-13, AKAP-Lbc, Breast Cancer Nuclear Receptor-binding Auxiliary Protein, Guanine Nucleotide Exchange Factor Lbc, Human Thyroid-anchoring Protein 31, Lymphoid Blast Crisis Oncogene, LBC Oncogene, Non-oncogenic Rho GTPase-specific GTP Exchange Factor, Protein Kinase A-anchoring Protein 13, PRKA13, p47, BRX, HT31, LBC) (Biotin)
Größe
£927.00
- SKU:
- 123135-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-111 from AKAP13 (NP_006729) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- AKAP13 functions as a protein kinase A (PKA)-anchoring protein and acts as an adapter protein to selectively couple G alpha-13 and Rho. It contains a dbl oncogene homology (DH) domain and a pleckstrin homology (PH) domain. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins. AKAP13 augments gene activation by the estrogen receptor and activates estrogen receptor beta by a p38 MAPK-dependent pathway. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice