AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705)

Größe

£685.00

SKU:: 123114
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa519-628 from MAGI2 (NP_036433) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Atrophin-1 (AIP1) contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.