AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2)

Größe

£685.00

SKU:: 123113
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa156-250 from AIP (NP_003968) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Ah receptor-associated protein (AIP) is also known as ARA9 and XAP2. This protein displays structural similarity to the glucocorticoid receptor-associated immunophilin FKBP52. Although they share significant homology, they have distinct cellular roles and biochemical properties. AIP is known to affect the potency and efficacy of AHR agonists in the yeast Saccharomyces cerevisiae as well as having functional consequence on AHR signal transduction. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.